PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4442_f_13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 1152aa    MW: 127584 Da    PI: 8.2225
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4442_f_13genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.5e-41143220178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCevhsk++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Neem_4442_f_13 143 MCQVDNCKEDLSNAKDYHRRHKVCEVHSKSSKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 220
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33138205IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.026141218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37142222IPR004333Transcription factor, SBP-box
PfamPF031101.6E-29144217IPR004333Transcription factor, SBP-box
CDDcd002043.31E-4849991No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1152 aa     Download sequence    Send to blast
MEEVGAQVAP PILMHQTLSS RFCEPPSMAR KRNLSYQNPN FHQHQHQHRA QPRLDNWNPK  60
LWNWDSVGFV AKPAESEAIR LGGAPASEPN KIDKKNITVS VANEDDGRLD LNLAGGLNTV  120
EEPASRPGKR VRSGSPGSAA YPMCQVDNCK EDLSNAKDYH RRHKVCEVHS KSSKALVGKQ  180
MQRFCQQCSR FHPLSEFDEG KRSCRRRLAG HNRRRRKTQP EDVTSRLLIP GNQNNATPHP  240
GNLDIVNLLT AFARAQGKSE EKSISCTPVP DRDQLIMILS KINSLPLPAD LAAKLPNIGS  300
SNKKNPEQTP SDFQNRLNLN TSSSSTMDLL AVLSATLATS APDALAMLSQ KSSHGSDSEK  360
TKSSCPDQTT PNFLKRTTLD FPSVGGERSS TSYQSPDSEG QVQETRVNLP LQLFSSSPED  420
DSPPKLSSSR KYFSSDSSNP IEERSPSSSP VMQTLFPMQS TSETVKSEKL SIGKEFNANF  480
AGSQTGGSVM PLELFGSSNK ATDNCSFQSF PYQAGYTSSS GSDHSPSSLN SDAQDSNVVI  540
PPQDRTGRII FKLFDKDPSH FPGTLRKQIY NWLSNSPSEM ESYIRPGCVV LSIYLSMSCA  600
AWEQLEGNLL QNVNSLVQDL DSDFWRKARF LVHTGKQLAS HKEVSAWCLI LLYTDDPNGN  660
GYNSWKIRVC KSWRTWSSPE LISVSPLAVV GGQEISLKLR GRNLTNPGTK IHCTFMGGYA  720
SQEVTGLTCR GTMYDEINLG GLKFQDTCTS VFGRFFVEVE NGFKGNSFPV IIADATICKE  780
LRLLESEFDA EAKICDIISE DQAHDYGRPR SREEVLHFLN ELGWLFQRKR TSSVIEGHIY  840
SFSRFKFLLI FSVERGCCAL VKAILDMLVE GNLTMDGLSR ESFEMLSEIQ LLNRAVKRRC  900
RRMVDLLIHY SITSSSETSP KYIFAPNLAG PGGITPLHLA ASASDSEDVI DALTNDPQEI  960
GLSCWNSLLD AGGQSPYSYA IMRNNHSYNK LVARKLSDKR NGQVSILVGM EIEQPGLTAD  1020
QGHGIKQGRK SCTKCAVVAA KFNRRVRGSQ GLLHRPYIHS MLAIAAVCVC VCLFLRGSPD  1080
IGLVAPFKWE NLDYGPNLEE VFSDCGNVAA AYNTEVKGCR FEVRRGGEIG VACYTLHLKK  1140
MDIYPYRHRI KI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32134217184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1893898RAVKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0154504e-34AC015450.5 Arabidopsis thaliana chromosome 1 BAC F14G6 genomic sequence, complete sequence.
GenBankCP0026844e-34CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435483.10.0hypothetical protein CICLE_v10000100mg
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A067H2Z60.0A0A067H2Z6_CITSI; Uncharacterized protein
TrEMBLV4SLU40.0V4SLU4_9R
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14